Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bartonella henselae ATP synthase subunit a (atpB)

This Recombinant Bartonella henselae ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-252.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q6G5L2

Expression Region

1-252

Origin

Bartonella henselae (strain ATCC 49882 / Houston 1) (Rochalimaea henselae)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSHAPDPVHQFEVSRLINISIGNMDLSFTNVSFFIVATVVVSSVFLFISSSSRGLVPTR MQSVSEMAYEFVASTLRESSGVQGMQFFPLVFSLFTFILVANFIGLFPYFYTITSQIMIT FSLAMLVIFTVISYGFYKHGVGFLKLFVPSGVPVLILPLVTMIEVISFFSRPISLSLRLF ANMLAGHITLKVFSGFIVSMIGIGIMGVGGSILPLIMTVAITALEFLVAFLQAYVFTVLT CMYLNDAVHPGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL8 antibody - C-terminal region (ARP40216_T100)
ARP40216_T100 100 µL

RPL8 antibody - C-terminal region (ARP40216_T100)

Sign In for Pricing
View Details
MHC Class 1, H-2Dd, H-2Kv, H-2k/q/s (MHC Class I, H-2Dd, H-2Kv, H-2k/q/s) (HRP)
MBS6251070-01 0.1 mL

MHC Class 1, H-2Dd, H-2Kv, H-2k/q/s (MHC Class I, H-2Dd, H-2Kv, H-2k/q/s) (HRP)

Sign In for Pricing
View Details
MHC Class 1, H-2Dd, H-2Kv, H-2k/q/s (MHC Class I, H-2Dd, H-2Kv, H-2k/q/s) (HRP)
MBS6251070-02 5x 0.1 mL

MHC Class 1, H-2Dd, H-2Kv, H-2k/q/s (MHC Class I, H-2Dd, H-2Kv, H-2k/q/s) (HRP)

Sign In for Pricing
View Details
Recombinant Immunoglobulin Superfamily, Member 2 (IGSF2)
SIPB958Hu01-01 10 µg

Recombinant Immunoglobulin Superfamily, Member 2 (IGSF2)

Sign In for Pricing
View Details
Recombinant Immunoglobulin Superfamily, Member 2 (IGSF2)
SIPB958Hu01-02 50 µg

Recombinant Immunoglobulin Superfamily, Member 2 (IGSF2)

Sign In for Pricing
View Details
Recombinant Immunoglobulin Superfamily, Member 2 (IGSF2)
SIPB958Hu01-03 200 µg

Recombinant Immunoglobulin Superfamily, Member 2 (IGSF2)

Sign In for Pricing
View Details