Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Cytochrome b561 (CYB561)

This Recombinant Pig Cytochrome b561 (CYB561) spans the amino acid sequence from region 1-252.

Product Specifications

Product Name Alternative

Cytochrome b561, Cytochrome b-561

UniProt

Q95245

Expression Region

1-252

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESPAGRTPAPGALPYYVAFSQLLGLTVVAVTGAWLGAYRGGIAWESALQFNVHPLCMII GLVFLQGDALLVYRVFRNEAKRTTKILHGLLHVLAFVIALVGLVAVFDYHRKKGIADLYS LHSWCGILVFVLFLAQWLVGLGFFLFPGASFSLRSRYRPQHVFFGAAIFLLSVGTALLGL KEALLFQLGTKYSAFESEGVLANVLGLLLVAFGAVVLYILTRADWKRPLQAEEQALSMDF KTLTEGDSPSSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RO (UCHL-1), CF640R conjugate, 0.1mg/mL
BNC400003-100 1x 100 µL

CD45RO (UCHL-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF405S conjugate, 0.1mg/mL
BNC040437-100 1x 100 µL

CD47 (B6H12.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF488A conjugate, 0.1mg/mL
BNC880008-100 1x 100 µL

MAGE A1 (MA454), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TTF-1 / NKX2.1 (Thyroid & Lung Epithelial Marker) (rNX2.1/690), CF594 conjugate, 0.1mg/mL
BNC941853-100 1x 100 µL

TTF-1 / NKX2.1 (Thyroid & Lung Epithelial Marker) (rNX2.1/690), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (GP1.4), CF568 conjugate, 0.1mg/mL
BNC680159-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (GP1.4), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-2 (BCL2/782), CF740 conjugate, 0.1mg/mL
BNC740782-100 1x 100 µL

Bcl-2 (BCL2/782), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details