Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bartonella bacilliformis ATP synthase subunit a (atpB)

This Recombinant Bartonella bacilliformis ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-252.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A1URU2

Expression Region

1-252

Origin

Bartonella bacilliformis (strain ATCC 35685 / KC583)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSHAPDPIHQFEISRLINVSIGNVDFSFTNVSFFIIATVVLSSVFLFISSSSRRLVPTR MQSISEMAYEFVASTLRESAGVQGMKFFPLVFSLFVFILVANFIGLFPYFYTITSQIMIT FSLAMLVILTVIGCGFYKHGIGFLKLFVPSGVPVMILPLVTVIEVISFFSRPISLSLRLF ANMLAGHITLKVFSGFIVSMVGLGFIGVGGSILPLIMTVAITALEFLVAFLQAYVFTVLT CMYLNDAVHPGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Crr Antibody
orb824506 2 mg

Crr Antibody

Sign In for Pricing
View Details
Human MACC1 siRNA
abx923253-01 15 nmol

Human MACC1 siRNA

Sign In for Pricing
View Details
Human MACC1 siRNA
abx923253-02 30 nmol

Human MACC1 siRNA

Sign In for Pricing
View Details
KIN Antibody - middle region
ARP31690_P050-25UL 25 µL

KIN Antibody - middle region

Sign In for Pricing
View Details
ZnT-10 Double Nickase Plasmid (h)
sc-403451-NIC 20 µg

ZnT-10 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
SNAPC 50 Double Nickase Plasmid (m)
sc-429561-NIC 20 µg

SNAPC 50 Double Nickase Plasmid (m)

Sign In for Pricing
View Details