Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bartonella bacilliformis ATP synthase subunit a (atpB)

This Recombinant Bartonella bacilliformis ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-252.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A1URU2

Expression Region

1-252

Origin

Bartonella bacilliformis (strain ATCC 35685 / KC583)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSHAPDPIHQFEISRLINVSIGNVDFSFTNVSFFIIATVVLSSVFLFISSSSRRLVPTR MQSISEMAYEFVASTLRESAGVQGMKFFPLVFSLFVFILVANFIGLFPYFYTITSQIMIT FSLAMLVILTVIGCGFYKHGIGFLKLFVPSGVPVMILPLVTVIEVISFFSRPISLSLRLF ANMLAGHITLKVFSGFIVSMVGLGFIGVGGSILPLIMTVAITALEFLVAFLQAYVFTVLT CMYLNDAVHPGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HNF1 alpha (HNF1A) (NM_000545) Human Recombinant Protein
TP311201L 1 mg

HNF1 alpha (HNF1A) (NM_000545) Human Recombinant Protein

Sign In for Pricing
View Details
Phencyclidine antibody
MBS531482-01 1 mg

Phencyclidine antibody

Sign In for Pricing
View Details
Phencyclidine antibody
MBS531482-02 5x 1 mg

Phencyclidine antibody

Sign In for Pricing
View Details
Rat Anti-bullous pemphigoid 180 antibody IgE ELISA Kit
MBS7279234-01 48 Well

Rat Anti-bullous pemphigoid 180 antibody IgE ELISA Kit

Sign In for Pricing
View Details
Rat Anti-bullous pemphigoid 180 antibody IgE ELISA Kit
MBS7279234-02 96 Well

Rat Anti-bullous pemphigoid 180 antibody IgE ELISA Kit

Sign In for Pricing
View Details
Rat Anti-bullous pemphigoid 180 antibody IgE ELISA Kit
MBS7279234-03 5x 96 Well

Rat Anti-bullous pemphigoid 180 antibody IgE ELISA Kit

Sign In for Pricing
View Details