Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein yhcE (yhcE)

This Recombinant Bacillus subtilis Uncharacterized protein yhcE (yhcE) spans the amino acid sequence from region 1-253.

Product Specifications

Product Name Alternative

Uncharacterized protein yhcE

UniProt

P54589

Expression Region

1-253

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSFLGLLKKDIKLSRMWLLVWICGIIFLLGTGHIIASRTKEPLVIFGFFVAVAFFLLFL SPVFVFYHLRKEGKSQLWLYNPNGGLWLFSSKLAASLLYQFVIQLALTAYGIWMYHMLSV KNLLEHQVDITSTVALLNMYGLISSLDMSVTVIVFWTVFHSLRNWRGMRWAAMVLLVAMW LFFDEYIISPLVESQKHFWPVTVYCNFDFHFHNVWRLELKPIHLSVLGFPIAIVITFLLL IMASKLLDRKVEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

T-Box Protein 3 (TBX3)
152138 200 µL

T-Box Protein 3 (TBX3)

Sign In for Pricing
View Details
FEN1 Rabbit Polyclonal Antibody (PE)
orb2608067 100 µg

FEN1 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Uncoupling Protein 2 (UCP2, UCPH, BMIQ4, Solute Carrier Family 25 Member 8, SLC25A8) (MaxLight 750)
MBS6442576-01 0.1 mL

Uncoupling Protein 2 (UCP2, UCPH, BMIQ4, Solute Carrier Family 25 Member 8, SLC25A8) (MaxLight 750)

Sign In for Pricing
View Details
Uncoupling Protein 2 (UCP2, UCPH, BMIQ4, Solute Carrier Family 25 Member 8, SLC25A8) (MaxLight 750)
MBS6442576-02 5x 0.1 mL

Uncoupling Protein 2 (UCP2, UCPH, BMIQ4, Solute Carrier Family 25 Member 8, SLC25A8) (MaxLight 750)

Sign In for Pricing
View Details
Rabbit Anti-Human UVRAG Polyclonal
MBS807423-01 0.1 mg

Rabbit Anti-Human UVRAG Polyclonal

Sign In for Pricing
View Details
Rabbit Anti-Human UVRAG Polyclonal
MBS807423-02 5x 0.1 mg

Rabbit Anti-Human UVRAG Polyclonal

Sign In for Pricing
View Details