Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sulfolobus islandicus Cobalamin synthase (cobS)

This Recombinant Sulfolobus islandicus Cobalamin synthase (cobS) spans the amino acid sequence from region 1-253.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

C4KJU4

Expression Region

1-253

Origin

Sulfolobus islandicus (strain M.16.4 / Kamchatka #3)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRLKGVLALFSFFTAIPIKSNASLEEIAEYSYISPLIIGISLALIESAVYVLLYRILEAL AGIVLLGVVELLRGFNHLDGLLDLGDALMIKGDRERKIKALKDVEIGSGGIGLLLVYLSI QIVALLKLGFSFYTIFYLISSNVLSMTIGLYILSTISPIPESNLGKIFHNKLKGKSTVLL FELIPFISLYNIIVFLVFYMIMHKICRSLGGSSGDIAGASITLSFPLFLLTNEITNLNYS LLSILCYLFLHLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR4A47 (NM_001005512) Human Over-expression Lysate
LY423615 100 µg

OR4A47 (NM_001005512) Human Over-expression Lysate

Sign In for Pricing
View Details
LILRB5 (NM_001081443) Human Over-expression Lysate
LY421153 100 µg

LILRB5 (NM_001081443) Human Over-expression Lysate

Sign In for Pricing
View Details
Fmoc-Asp (t-Bu) Wang Resin
H0751501305.1G 1 g

Fmoc-Asp (t-Bu) Wang Resin

Sign In for Pricing
View Details
Human HTF9C (TRMT2A) activation kit by CRISPRa
GA108979 1 Kit

Human HTF9C (TRMT2A) activation kit by CRISPRa

Sign In for Pricing
View Details
Human ZFP14 activation kit by CRISPRa
GA111676 1 Kit

Human ZFP14 activation kit by CRISPRa

Sign In for Pricing
View Details
IL31RA Rabbit Polyclonal Antibody
TA377467 100 µL

IL31RA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details