Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sulfolobus islandicus Cobalamin synthase (cobS)

This Recombinant Sulfolobus islandicus Cobalamin synthase (cobS) spans the amino acid sequence from region 1-253.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

C4KJU4

Expression Region

1-253

Origin

Sulfolobus islandicus (strain M.16.4 / Kamchatka #3)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRLKGVLALFSFFTAIPIKSNASLEEIAEYSYISPLIIGISLALIESAVYVLLYRILEAL AGIVLLGVVELLRGFNHLDGLLDLGDALMIKGDRERKIKALKDVEIGSGGIGLLLVYLSI QIVALLKLGFSFYTIFYLISSNVLSMTIGLYILSTISPIPESNLGKIFHNKLKGKSTVLL FELIPFISLYNIIVFLVFYMIMHKICRSLGGSSGDIAGASITLSFPLFLLTNEITNLNYS LLSILCYLFLHLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dipyrrolidinylthiuram Disulfide
TRC-D263053-500MG 500 mg

Dipyrrolidinylthiuram Disulfide

Sign In for Pricing
View Details
Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (IG1707R), CF647 conjugate, 0.1mg/mL
BNC471707-100 1x 100 µL

Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (IG1707R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NR2C1 (NM_001032287) Human Over-expression Lysate
LY422297 100 µg

NR2C1 (NM_001032287) Human Over-expression Lysate

Sign In for Pricing
View Details
Benzyl 2,3,4-Tri-O-benzyl-Alpha-D-mannopyranoside
TRC-B315900-500MG 500 mg

Benzyl 2,3,4-Tri-O-benzyl-Alpha-D-mannopyranoside

Sign In for Pricing
View Details
Canine C-Peptide ELISA Kit
RD-C-Peptide-c-01 96 Tests

Canine C-Peptide ELISA Kit

Sign In for Pricing
View Details
Canine C-Peptide ELISA Kit
RD-C-Peptide-c-02 48 Tests

Canine C-Peptide ELISA Kit

Sign In for Pricing
View Details