Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine 3-hydroxyacyl-CoA dehydratase 2 (PTPLB)

This Recombinant Bovine 3-hydroxyacyl-CoA dehydratase 2 (PTPLB) spans the amino acid sequence from region 2-254.

Product Specifications

Product Name Alternative

3-hydroxyacyl-CoA dehydratase 2, HACD2, EC= 4.2.1.-, Protein-tyrosine phosphatase-like member B

UniProt

Q2KIP8

Expression Region

2-254

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AAAAAIAASKGNGGGGGRAGAGEASSSRRKKGPGPLTTAYLVIYNVVMTAGWLVIAVGLV RAYLAKGSYHSLYYSIEKPLKFFQTGALLEILHCAIGIVPSSVVLTSIQVMSRVFLIWAV THSVKEVQSEDSVLLFVIAWTITEIIRYSFYTFSLLNHLPYLIKWARYTLFIVLYPMGVS GELLTIYAALPFVRQAGLYSISLPNKYNFSFDYYAFLILIMISYIPLFPQLYFHMIHQRR KILSHTEEHKKFE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse CADM3 Protein (His Tag)
PKSM040660 100 µg

Recombinant Mouse CADM3 Protein (His Tag)

Sign In for Pricing
View Details
ER81 (ETV1) (NM_001163150) Human Over-expression Lysate
LC431376 20 µg

ER81 (ETV1) (NM_001163150) Human Over-expression Lysate

Sign In for Pricing
View Details
Fmr1nb (BC099411) Mouse Tagged ORF Clone
MG201846 10 µg

Fmr1nb (BC099411) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Fluo -2 AM - Green fluorescent calcium indicator
1021G 5x 50 µg

Fluo -2 AM - Green fluorescent calcium indicator

Sign In for Pricing
View Details
MRPL12 (NM_002949) Human Over-expression Lysate
LY418996 100 µg

MRPL12 (NM_002949) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant FAK (phospho Y397) Antibody
RC-4465-01 50 μL

Recombinant FAK (phospho Y397) Antibody

Sign In for Pricing
View Details