Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine 3-hydroxyacyl-CoA dehydratase 2 (PTPLB)

This Recombinant Bovine 3-hydroxyacyl-CoA dehydratase 2 (PTPLB) spans the amino acid sequence from region 2-254.

Product Specifications

Product Name Alternative

3-hydroxyacyl-CoA dehydratase 2, HACD2, EC= 4.2.1.-, Protein-tyrosine phosphatase-like member B

UniProt

Q2KIP8

Expression Region

2-254

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AAAAAIAASKGNGGGGGRAGAGEASSSRRKKGPGPLTTAYLVIYNVVMTAGWLVIAVGLV RAYLAKGSYHSLYYSIEKPLKFFQTGALLEILHCAIGIVPSSVVLTSIQVMSRVFLIWAV THSVKEVQSEDSVLLFVIAWTITEIIRYSFYTFSLLNHLPYLIKWARYTLFIVLYPMGVS GELLTIYAALPFVRQAGLYSISLPNKYNFSFDYYAFLILIMISYIPLFPQLYFHMIHQRR KILSHTEEHKKFE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phytolaccagenin
TRC-P399478-1MG 1 mg

Phytolaccagenin

Sign In for Pricing
View Details
Cytochrome C (CTC05), CF640R conjugate, 0.1mg/mL
BNC400887-500 1x 500 µL

Cytochrome C (CTC05), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cdk1 / p34cdc2 Serine-Threonine Kinase (A17.1.1), CF640R conjugate, 0.1mg/mL
BNC401083-500 1x 500 µL

Cdk1 / p34cdc2 Serine-Threonine Kinase (A17.1.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TEC (NM_003215) Human Over-expression Lysate
LY418830 100 µg

TEC (NM_003215) Human Over-expression Lysate

Sign In for Pricing
View Details
DOG-1 (DOG1.1), 1mg/mL
BNUM0725-50 1x 50 µL

DOG-1 (DOG1.1), 1mg/mL

Sign In for Pricing
View Details
Lactal Hexaacetate
TRC-L112500-500MG 500 mg

Lactal Hexaacetate

Sign In for Pricing
View Details