Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine 3-hydroxyacyl-CoA dehydratase 2 (PTPLB)

This Recombinant Bovine 3-hydroxyacyl-CoA dehydratase 2 (PTPLB) spans the amino acid sequence from region 2-254.

Product Specifications

Product Name Alternative

3-hydroxyacyl-CoA dehydratase 2, HACD2, EC= 4.2.1.-, Protein-tyrosine phosphatase-like member B

UniProt

Q2KIP8

Expression Region

2-254

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AAAAAIAASKGNGGGGGRAGAGEASSSRRKKGPGPLTTAYLVIYNVVMTAGWLVIAVGLV RAYLAKGSYHSLYYSIEKPLKFFQTGALLEILHCAIGIVPSSVVLTSIQVMSRVFLIWAV THSVKEVQSEDSVLLFVIAWTITEIIRYSFYTFSLLNHLPYLIKWARYTLFIVLYPMGVS GELLTIYAALPFVRQAGLYSISLPNKYNFSFDYYAFLILIMISYIPLFPQLYFHMIHQRR KILSHTEEHKKFE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCR Plates
PC10FS-9-W 50 Pack/Case

PCR Plates

Sign In for Pricing
View Details
Amdinocillin
TRC-A576300-500MG 500 mg

Amdinocillin

Sign In for Pricing
View Details
Rhodium Carbonyl Chloride
TRC-R318845-25MG 25 mg

Rhodium Carbonyl Chloride

Sign In for Pricing
View Details
Human STATIP1 (ELP2) activation kit by CRISPRa
GA110643 1 Kit

Human STATIP1 (ELP2) activation kit by CRISPRa

Sign In for Pricing
View Details
RRAS2 Rabbit Polyclonal Antibody
HA500379 100 µL

RRAS2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18) (rKRT18/1190), Biotin conjugate, 0.1mg/mL
BNCB3217-500 1x 500 µL

Cytokeratin 18 (KRT18) (rKRT18/1190), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details