Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 3-hydroxyacyl-CoA dehydratase 2 (PTPLB)

This Recombinant Human 3-hydroxyacyl-CoA dehydratase 2 (PTPLB) spans the amino acid sequence from region 2-254.

Product Specifications

Product Name Alternative

3-hydroxyacyl-CoA dehydratase 2, HACD2, EC= 4.2.1.-, Protein-tyrosine phosphatase-like member B

UniProt

Q6Y1H2

Expression Region

2-254

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AAVAATAAAKGNGGGGGRAGAGDASGTRKKKGPGPLATAYLVIYNVVMTAGWLVIAVGLV RAYLAKGSYHSLYYSIEKPLKFFQTGALLEILHCAIGIVPSSVVLTSFQVMSRVFLIWAV THSVKEVQSEDSVLLFVIAWTITEIIRYSFYTFSLLNHLPYLIKWARYTLFIVLYPMGVS GELLTIYAALPFVRQAGLYSISLPNKYNFSFDYYAFLILIMISYIPIFPQLYFHMIHQRR KILSHTEEHKKFE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Follicle Stimulating Hormone, beta (FSHb) (MaxLight 550)
F5900-02-ML550 100 µL

Follicle Stimulating Hormone, beta (FSHb) (MaxLight 550)

Sign In for Pricing
View Details
CA I siRNA (m)
sc-60308 10 µM

CA I siRNA (m)

Sign In for Pricing
View Details
Cattle OC (Osteocalcin) ELISA Kit
ELK11144-01 48 Tests

Cattle OC (Osteocalcin) ELISA Kit

Sign In for Pricing
View Details
Cattle OC (Osteocalcin) ELISA Kit
ELK11144-02 96 Tests

Cattle OC (Osteocalcin) ELISA Kit

Sign In for Pricing
View Details
Cattle OC (Osteocalcin) ELISA Kit
ELK11144-03 5x 96 Tests

Cattle OC (Osteocalcin) ELISA Kit

Sign In for Pricing
View Details
Anti-Mouse CD8 FITC
RM800830 100 Tests

Anti-Mouse CD8 FITC

Sign In for Pricing
View Details