Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 3-hydroxyacyl-CoA dehydratase 2 (PTPLB)

This Recombinant Human 3-hydroxyacyl-CoA dehydratase 2 (PTPLB) spans the amino acid sequence from region 2-254.

Product Specifications

Product Name Alternative

3-hydroxyacyl-CoA dehydratase 2, HACD2, EC= 4.2.1.-, Protein-tyrosine phosphatase-like member B

UniProt

Q6Y1H2

Expression Region

2-254

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AAVAATAAAKGNGGGGGRAGAGDASGTRKKKGPGPLATAYLVIYNVVMTAGWLVIAVGLV RAYLAKGSYHSLYYSIEKPLKFFQTGALLEILHCAIGIVPSSVVLTSFQVMSRVFLIWAV THSVKEVQSEDSVLLFVIAWTITEIIRYSFYTFSLLNHLPYLIKWARYTLFIVLYPMGVS GELLTIYAALPFVRQAGLYSISLPNKYNFSFDYYAFLILIMISYIPIFPQLYFHMIHQRR KILSHTEEHKKFE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human IgG+IgM+IgA - Alexa Fluor 568
DL87335A-01 100 µL

Rabbit Anti-Human IgG+IgM+IgA - Alexa Fluor 568

Sign In for Pricing
View Details
Rabbit Anti-Human IgG+IgM+IgA - Alexa Fluor 568
DL87335A-02 500 µL

Rabbit Anti-Human IgG+IgM+IgA - Alexa Fluor 568

Sign In for Pricing
View Details
Rabbit Anti-Human IgG+IgM+IgA - Alexa Fluor 568
DL87335A-03 1 mL

Rabbit Anti-Human IgG+IgM+IgA - Alexa Fluor 568

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster Opsin Rh5 (Rh5)
orb2904743-01 20 µg

Recombinant Drosophila melanogaster Opsin Rh5 (Rh5)

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster Opsin Rh5 (Rh5)
orb2904743-02 100 µg

Recombinant Drosophila melanogaster Opsin Rh5 (Rh5)

Sign In for Pricing
View Details
Pramipexole Nitroso Impurity 4
CS-EO-02916 1 Each

Pramipexole Nitroso Impurity 4

Sign In for Pricing
View Details