Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 3-hydroxyacyl-CoA dehydratase 2 (PTPLB)

This Recombinant Human 3-hydroxyacyl-CoA dehydratase 2 (PTPLB) spans the amino acid sequence from region 2-254.

Product Specifications

Product Name Alternative

3-hydroxyacyl-CoA dehydratase 2, HACD2, EC= 4.2.1.-, Protein-tyrosine phosphatase-like member B

UniProt

Q6Y1H2

Expression Region

2-254

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AAVAATAAAKGNGGGGGRAGAGDASGTRKKKGPGPLATAYLVIYNVVMTAGWLVIAVGLV RAYLAKGSYHSLYYSIEKPLKFFQTGALLEILHCAIGIVPSSVVLTSFQVMSRVFLIWAV THSVKEVQSEDSVLLFVIAWTITEIIRYSFYTFSLLNHLPYLIKWARYTLFIVLYPMGVS GELLTIYAALPFVRQAGLYSISLPNKYNFSFDYYAFLILIMISYIPIFPQLYFHMIHQRR KILSHTEEHKKFE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRHR1 Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-10248R-APC-Cy5.5 100 µL

CRHR1 Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
PSMC2 Peptide (AAP38189)
AAP38189-100UG 100 µg

PSMC2 Peptide (AAP38189)

Sign In for Pricing
View Details
ZNF474 Peptide - N-terminal region
MBS3225821-01 0.1 mg

ZNF474 Peptide - N-terminal region

Sign In for Pricing
View Details
ZNF474 Peptide - N-terminal region
MBS3225821-02 5x 0.1 mg

ZNF474 Peptide - N-terminal region

Sign In for Pricing
View Details
Human Protein C Inhibitor (PCI) ELISA Kit
RDR-PAI3-Hu-01 96 Tests

Human Protein C Inhibitor (PCI) ELISA Kit

Sign In for Pricing
View Details
Human Protein C Inhibitor (PCI) ELISA Kit
RDR-PAI3-Hu-02 48 Tests

Human Protein C Inhibitor (PCI) ELISA Kit

Sign In for Pricing
View Details