Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse 3-hydroxyacyl-CoA dehydratase 2 (Ptplb)

This Recombinant Mouse 3-hydroxyacyl-CoA dehydratase 2 (Ptplb) spans the amino acid sequence from region 2-254.

Product Specifications

Product Name Alternative

3-hydroxyacyl-CoA dehydratase 2, HACD2, EC= 4.2.1.-, Protein-tyrosine phosphatase-like member B

UniProt

Q9D3B1

Expression Region

2-254

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AAAAATAATKGNGGGSGRVGAGDSSGARKKKGPGPVATAYLVIYNVVMTAGWLVIAVGLV RAYLAKGSYHSLYYSIERPLKFFQTGALLEILHCAIGIVPSSVVLTSFQVMSRVFLIWAV THSVKEVQSEDSVLLFVIAWTITEIIRYSFYTFSLLNHLPYIIKWARYTLFIVLYPMGVT GELLTIYAALPFVRQAGLYSISLPNKYNFSFDYHAFLILIMISYIPLFPQLYFHMIHQRR KVLSHTEEHKKFE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MeOSuc-AAPV-pNA
BML-P213-0005 5 mg

MeOSuc-AAPV-pNA

Sign In for Pricing
View Details
Epidermal Growth Factor Receptor (erbB, EGFR) (BSA & Azide Free) (Biotin)
MBS6266308-01 0.1 mL

Epidermal Growth Factor Receptor (erbB, EGFR) (BSA & Azide Free) (Biotin)

Sign In for Pricing
View Details
Epidermal Growth Factor Receptor (erbB, EGFR) (BSA & Azide Free) (Biotin)
MBS6266308-02 5x 0.1 mL

Epidermal Growth Factor Receptor (erbB, EGFR) (BSA & Azide Free) (Biotin)

Sign In for Pricing
View Details
FATE1 Mouse Monoclonal Antibody [Clone ID: LBI6G10]
AMM13053VCF 100 µg

FATE1 Mouse Monoclonal Antibody [Clone ID: LBI6G10]

Sign In for Pricing
View Details
Lentiviral mouse Ldb3 shRNA (UAS) - Lentiviral mouse Ldb3 shRNA (UAS, RFP) (25)
GTR15283595 1 Vial

Lentiviral mouse Ldb3 shRNA (UAS) - Lentiviral mouse Ldb3 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Anti-COX5B Antibody, Rabbit Polyclonal
MBS8126280-01 0.1 mL

Anti-COX5B Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details