Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse 3-hydroxyacyl-CoA dehydratase 2 (Ptplb)

This Recombinant Mouse 3-hydroxyacyl-CoA dehydratase 2 (Ptplb) spans the amino acid sequence from region 2-254.

Product Specifications

Product Name Alternative

3-hydroxyacyl-CoA dehydratase 2, HACD2, EC= 4.2.1.-, Protein-tyrosine phosphatase-like member B

UniProt

Q9D3B1

Expression Region

2-254

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AAAAATAATKGNGGGSGRVGAGDSSGARKKKGPGPVATAYLVIYNVVMTAGWLVIAVGLV RAYLAKGSYHSLYYSIERPLKFFQTGALLEILHCAIGIVPSSVVLTSFQVMSRVFLIWAV THSVKEVQSEDSVLLFVIAWTITEIIRYSFYTFSLLNHLPYIIKWARYTLFIVLYPMGVT GELLTIYAALPFVRQAGLYSISLPNKYNFSFDYHAFLILIMISYIPLFPQLYFHMIHQRR KVLSHTEEHKKFE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FGF17 knockout cell line
ABC-KH5512 1 Vial

Human FGF17 knockout cell line

Sign In for Pricing
View Details
FAP Antibody
orb2674710-01 50 µL

FAP Antibody

Sign In for Pricing
View Details
FAP Antibody
orb2674710-02 100 µL

FAP Antibody

Sign In for Pricing
View Details
FAP Antibody
orb2674710-03 200 µL

FAP Antibody

Sign In for Pricing
View Details
BHMT2 (S-Methylmethionine--Homocysteine S-Methyltransferase BHMT2, Betaine--Homocysteine S-Methyltransferase 2)
476234 100 µL

BHMT2 (S-Methylmethionine--Homocysteine S-Methyltransferase BHMT2, Betaine--Homocysteine S-Methyltransferase 2)

Sign In for Pricing
View Details
Mouse IL-4 Rat Monoclonal Antibody (APC)
orb2648547-01 50 Tests

Mouse IL-4 Rat Monoclonal Antibody (APC)

Sign In for Pricing
View Details