Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse 3-hydroxyacyl-CoA dehydratase 2 (Ptplb)

This Recombinant Mouse 3-hydroxyacyl-CoA dehydratase 2 (Ptplb) spans the amino acid sequence from region 2-254.

Product Specifications

Product Name Alternative

3-hydroxyacyl-CoA dehydratase 2, HACD2, EC= 4.2.1.-, Protein-tyrosine phosphatase-like member B

UniProt

Q9D3B1

Expression Region

2-254

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AAAAATAATKGNGGGSGRVGAGDSSGARKKKGPGPVATAYLVIYNVVMTAGWLVIAVGLV RAYLAKGSYHSLYYSIERPLKFFQTGALLEILHCAIGIVPSSVVLTSFQVMSRVFLIWAV THSVKEVQSEDSVLLFVIAWTITEIIRYSFYTFSLLNHLPYIIKWARYTLFIVLYPMGVT GELLTIYAALPFVRQAGLYSISLPNKYNFSFDYHAFLILIMISYIPLFPQLYFHMIHQRR KVLSHTEEHKKFE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant SOX9 Antibody
V8091-20UG 20 µg

Recombinant SOX9 Antibody

Sign In for Pricing
View Details
5-Hydroxy-1-(1-piperazinyl)-1-pentanone
TRC-H949835-2.5G 2.5 g

5-Hydroxy-1-(1-piperazinyl)-1-pentanone

Sign In for Pricing
View Details
GLI1 Recombinant Rabbit Monoclonal Antibody
orb704320-01 50 μL

GLI1 Recombinant Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
GLI1 Recombinant Rabbit Monoclonal Antibody
orb704320-02 100 µL

GLI1 Recombinant Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant African swine fever virus Polyprotein pp220 (Ken-104), partial
MBS1065672 Inquire

Recombinant African swine fever virus Polyprotein pp220 (Ken-104), partial

Sign In for Pricing
View Details
Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0697 (AF_0697), partial
MBS1117853-01 0.5 mg (E-Coli)

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0697 (AF_0697), partial

Sign In for Pricing
View Details