Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Desulfitobacterium hafniense Cobalamin synthase (cobS)

This Recombinant Desulfitobacterium hafniense Cobalamin synthase (cobS) spans the amino acid sequence from region 1-254.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q24VN7

Expression Region

1-254

Origin

Desulfitobacterium hafniense (strain Y51)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPSMRKLWIALTFLTRIPLPQPEQVTSEEFTQSQHYYPLVGLILGGALWLALTLLLPHYP PLVTAALLLALELILTGGIHLDGLMDSMDGLLSARTPERMLEIMKDSHVGAFGALSAMVY LLLKFSLLAGLLALSSPLVPYLVLFMPILSRWIFLIGVHYFPYARAQGFGQGFHETSRQT RWLFLGEGLLLLFLTYWVLQWPGIAGFILATLFILLFTRKVSRLLGGLTGDLYGASIELS ELLFLLGAFPLLYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn2r45 Mouse Gene Knockout Kit (CRISPR)
KN519174 1 Kit

Vmn2r45 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RUNDC3B (NM_001134405) Human Over-expression Lysate
LY427421 100 µg

RUNDC3B (NM_001134405) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon
CS702722 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details
ZNF720 (Center) Rabbit Polyclonal Antibody
AP54715PU-N 400 µL

ZNF720 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Synaptotagmin 1 (SYT1) Rabbit Polyclonal Antibody
AP09507PU-S 50 µL

Synaptotagmin 1 (SYT1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Dystrobrevin beta (DTNB) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E3]
TA504378AM 100 µL

Dystrobrevin beta (DTNB) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E3]

Sign In for Pricing
View Details