Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii 3-hydroxyacyl-CoA dehydratase 2 (PTPLB)

This Recombinant Pongo abelii 3-hydroxyacyl-CoA dehydratase 2 (PTPLB) spans the amino acid sequence from region 2-255.

Product Specifications

Product Name Alternative

3-hydroxyacyl-CoA dehydratase 2, HACD2, EC= 4.2.1.-, Protein-tyrosine phosphatase-like member B

UniProt

Q5RBK3

Expression Region

2-255

Origin

Pongo abelii (Sumatran orangutan)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AAAAAATAAAKGNGGGGGRAGAGDASGTRKKKGPGPLATAYLVIYNVVMTAGWLVIAVGL VRAYLAKGSYHSLYYSIEKPLKFFQTGALLEILHCAIGIVPSSVVLTSFQVMSRVFLIWA VTHSVKEVQSEDSVLLFVIAWTITEIIRYSFYTFSLLNHLPYLIKWARYTLFIVLYPMGV SGELLTIYAALPFVRQAGLYSISLPNKYNFSFDYYAFLILIMISYIPIFPQLYFHMIHQR RKILSHTEEHKKFE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMPD2 (Center) Rabbit Polyclonal Antibody
AP50165PU-N 400 µL

AMPD2 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Isopropyl 2-(2-oxopyrrolidin-1-yl)acetate
TRC-I824075-250MG 250 mg

Isopropyl 2-(2-oxopyrrolidin-1-yl)acetate

Sign In for Pricing
View Details
Mouse 4921524L21Rik activation kit by CRISPRa
GA208661 1 Kit

Mouse 4921524L21Rik activation kit by CRISPRa

Sign In for Pricing
View Details
HER-4 / ERBB4 (ERBB4/2581), 0.2mg/mL
BNUB2581-100 1x 100 µL

HER-4 / ERBB4 (ERBB4/2581), 0.2mg/mL

Sign In for Pricing
View Details
Anti-CERB1
Y058516 100 µL

Anti-CERB1

Sign In for Pricing
View Details
Marapsin (PRSS27) Human Gene Knockout Kit (CRISPR)
KN421326 1 Kit

Marapsin (PRSS27) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details