Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii 3-hydroxyacyl-CoA dehydratase 2 (PTPLB)

This Recombinant Pongo abelii 3-hydroxyacyl-CoA dehydratase 2 (PTPLB) spans the amino acid sequence from region 2-255.

Product Specifications

Product Name Alternative

3-hydroxyacyl-CoA dehydratase 2, HACD2, EC= 4.2.1.-, Protein-tyrosine phosphatase-like member B

UniProt

Q5RBK3

Expression Region

2-255

Origin

Pongo abelii (Sumatran orangutan)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AAAAAATAAAKGNGGGGGRAGAGDASGTRKKKGPGPLATAYLVIYNVVMTAGWLVIAVGL VRAYLAKGSYHSLYYSIEKPLKFFQTGALLEILHCAIGIVPSSVVLTSFQVMSRVFLIWA VTHSVKEVQSEDSVLLFVIAWTITEIIRYSFYTFSLLNHLPYLIKWARYTLFIVLYPMGV SGELLTIYAALPFVRQAGLYSISLPNKYNFSFDYYAFLILIMISYIPIFPQLYFHMIHQR RKILSHTEEHKKFE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Parkin Antibody [JF82-09]
ET1702-60TR 20 µL

Anti-Parkin Antibody [JF82-09]

Sign In for Pricing
View Details
DDX59 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3C3]
TA800428BM 100 µL

DDX59 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3C3]

Sign In for Pricing
View Details
MALT-1 (MT1/410), Biotin conjugate, 0.1mg/mL
BNCB0410-500 1x 500 µL

MALT-1 (MT1/410), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rad51b Mouse Gene Knockout Kit (CRISPR)
KN514417 1 Kit

Rad51b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human FXC1 (TIMM10B) activation kit by CRISPRa
GA108884 1 Kit

Human FXC1 (TIMM10B) activation kit by CRISPRa

Sign In for Pricing
View Details
Boc-Ala-Osu
TRC-B619575-1G 1 g

Boc-Ala-Osu

Sign In for Pricing
View Details