Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii 3-hydroxyacyl-CoA dehydratase 2 (PTPLB)

This Recombinant Pongo abelii 3-hydroxyacyl-CoA dehydratase 2 (PTPLB) spans the amino acid sequence from region 2-255.

Product Specifications

Product Name Alternative

3-hydroxyacyl-CoA dehydratase 2, HACD2, EC= 4.2.1.-, Protein-tyrosine phosphatase-like member B

UniProt

Q5RBK3

Expression Region

2-255

Origin

Pongo abelii (Sumatran orangutan)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AAAAAATAAAKGNGGGGGRAGAGDASGTRKKKGPGPLATAYLVIYNVVMTAGWLVIAVGL VRAYLAKGSYHSLYYSIEKPLKFFQTGALLEILHCAIGIVPSSVVLTSFQVMSRVFLIWA VTHSVKEVQSEDSVLLFVIAWTITEIIRYSFYTFSLLNHLPYLIKWARYTLFIVLYPMGV SGELLTIYAALPFVRQAGLYSISLPNKYNFSFDYYAFLILIMISYIPIFPQLYFHMIHQR RKILSHTEEHKKFE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Natriuretic Peptide Receptor C (NPR3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI11H5]
TA501078BM 100 µL

Natriuretic Peptide Receptor C (NPR3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI11H5]

Sign In for Pricing
View Details
Fibronectin (FN1/2949), CF640R conjugate, 0.1mg/mL
BNC402949-500 1x 500 µL

Fibronectin (FN1/2949), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CADPS2 Human Gene Knockout Kit (CRISPR)
KN416560 1 Kit

CADPS2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human BMP-9 protein (His Tag)
PKSH034136-01 20 µg

Recombinant Human BMP-9 protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human BMP-9 protein (His Tag)
PKSH034136-02 100 µg

Recombinant Human BMP-9 protein (His Tag)

Sign In for Pricing
View Details
APC6 Antibody
8C12166-AAT 50 µg

APC6 Antibody

Sign In for Pricing
View Details