Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vibrio vulnificus Cobalamin synthase (cobS)

This Recombinant Vibrio vulnificus Cobalamin synthase (cobS) spans the amino acid sequence from region 1-255.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q7MLF2

Expression Region

1-255

Origin

Vibrio vulnificus (strain YJ016)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKTWQYQYQLFCLAVSFFSRLPVPKSTPYSDERMNQAGRYFALVGTLLGLLCVLVYAFAS LFFPYQVAIVLMMAFSLLLTGAFHEDGLTDMADGIGGGMTLDKRLTIMKDSRIGTYGSAT LTMALIGKFVFLTTLARQPDFGLMIVVAYTLSRAVAATLIYDMPYVSDSDTSKSKPLANA QSSTELAILILTGVLAAISLGLGVGLLLILFAILFRWAFKRWLLARLGGFTGDCLGGAQQ LMELGIYLVLIAVVQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) CHX5 Polyclonal Antibody
MBS7194023 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) CHX5 Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Bcl-6 Antibody (SPM602) - Azide and BSA Free
NBP3-08851 100 µg

Mouse Monoclonal Bcl-6 Antibody (SPM602) - Azide and BSA Free

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Meteorin (METRN)
MBS2080114-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Meteorin (METRN)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Meteorin (METRN)
MBS2080114-02 0.2 mL

Cy3-Linked Polyclonal Antibody to Meteorin (METRN)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Meteorin (METRN)
MBS2080114-03 0.5 mL

Cy3-Linked Polyclonal Antibody to Meteorin (METRN)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Meteorin (METRN)
MBS2080114-04 1 mL

Cy3-Linked Polyclonal Antibody to Meteorin (METRN)

Sign In for Pricing
View Details