Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vibrio vulnificus Cobalamin synthase (cobS)

This Recombinant Vibrio vulnificus Cobalamin synthase (cobS) spans the amino acid sequence from region 1-255.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q7MLF2

Expression Region

1-255

Origin

Vibrio vulnificus (strain YJ016)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKTWQYQYQLFCLAVSFFSRLPVPKSTPYSDERMNQAGRYFALVGTLLGLLCVLVYAFAS LFFPYQVAIVLMMAFSLLLTGAFHEDGLTDMADGIGGGMTLDKRLTIMKDSRIGTYGSAT LTMALIGKFVFLTTLARQPDFGLMIVVAYTLSRAVAATLIYDMPYVSDSDTSKSKPLANA QSSTELAILILTGVLAAISLGLGVGLLLILFAILFRWAFKRWLLARLGGFTGDCLGGAQQ LMELGIYLVLIAVVQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCGF5 (NM_032373) Human Over-expression Lysate
LC410166 20 µg

PCGF5 (NM_032373) Human Over-expression Lysate

Sign In for Pricing
View Details
Valproic Acid Antibody
abx021084 1 mg

Valproic Acid Antibody

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) Mouse Monoclonal Antibody
MBS439767-01 0.02 mg (With BSA & Azide at 0.2mg/mL)

HLA-Aw32 & HLA-A25 (MHC I) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) Mouse Monoclonal Antibody
MBS439767-02 0.1 mg (With BSA & Azide at 0.2mg/mL)

HLA-Aw32 & HLA-A25 (MHC I) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) Mouse Monoclonal Antibody
MBS439767-03 0.1 mg (Without BSA & Azide at 1mg/mL)

HLA-Aw32 & HLA-A25 (MHC I) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) Mouse Monoclonal Antibody
MBS439767-04 5x 0.1 mg (With BSA & Azide at 0.2mg/mL)

HLA-Aw32 & HLA-A25 (MHC I) Mouse Monoclonal Antibody

Sign In for Pricing
View Details