Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cobalamin synthase (cobS)

This Recombinant Cobalamin synthase (cobS) spans the amino acid sequence from region 1-255.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q8D922

Expression Region

1-255

Origin

Vibrio vulnificus

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKTWQYQYQLFCLAVSFFSRLPVPKSTPYSDERMNQAGRYFALVGTLLGLLCVLVYAFAS LFFPYQVAIVLMMAFSLLLTGAFHEDGLTDMADGIGGGMTLDKRLTIMKDSRIGTYGSAT LTMALIGKFVFLTTLARQPDFGLMIVVAYTLSRAVAATLIYDMPYVSDSDTSKSKPLANA QSSTELAILILTGVLAAISLGLGVGLLLILFAILFRWAFKRWLLARLGGFTGDCLGGAQQ LMELGIYLVLIAVVQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Immunodeficiency Virus Type-1 p24 (Capsid protein p24, Human immunodeficiency virus type 1 p24, HIV1gp1, HIV-1 Gag p24) (AP) discontinued
168800-AF-AP 100 µL

Human Immunodeficiency Virus Type-1 p24 (Capsid protein p24, Human immunodeficiency virus type 1 p24, HIV1gp1, HIV-1 Gag p24) (AP) discontinued

Sign In for Pricing
View Details
Recombinant Shigella sonnei Spermidine export protein MdtJ (mdtJ)
orb2922008-01 20 µg

Recombinant Shigella sonnei Spermidine export protein MdtJ (mdtJ)

Sign In for Pricing
View Details
Recombinant Shigella sonnei Spermidine export protein MdtJ (mdtJ)
orb2922008-02 100 µg

Recombinant Shigella sonnei Spermidine export protein MdtJ (mdtJ)

Sign In for Pricing
View Details
POLL, 1-300aa, Human, His tag, E Coli
MBS204443-01 0.01 mg

POLL, 1-300aa, Human, His tag, E Coli

Sign In for Pricing
View Details
POLL, 1-300aa, Human, His tag, E Coli
MBS204443-02 0.02 mg

POLL, 1-300aa, Human, His tag, E Coli

Sign In for Pricing
View Details
POLL, 1-300aa, Human, His tag, E Coli
MBS204443-03 0.05 mg

POLL, 1-300aa, Human, His tag, E Coli

Sign In for Pricing
View Details