Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cobalamin synthase (cobS)

This Recombinant Cobalamin synthase (cobS) spans the amino acid sequence from region 1-255.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q8D922

Expression Region

1-255

Origin

Vibrio vulnificus

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKTWQYQYQLFCLAVSFFSRLPVPKSTPYSDERMNQAGRYFALVGTLLGLLCVLVYAFAS LFFPYQVAIVLMMAFSLLLTGAFHEDGLTDMADGIGGGMTLDKRLTIMKDSRIGTYGSAT LTMALIGKFVFLTTLARQPDFGLMIVVAYTLSRAVAATLIYDMPYVSDSDTSKSKPLANA QSSTELAILILTGVLAAISLGLGVGLLLILFAILFRWAFKRWLLARLGGFTGDCLGGAQQ LMELGIYLVLIAVVQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vascular Endothelial Growth Factor Receptor 1 (VEGFR1) Recombinant, Porcine
157315-01 10 µg

Vascular Endothelial Growth Factor Receptor 1 (VEGFR1) Recombinant, Porcine

Sign In for Pricing
View Details
Vascular Endothelial Growth Factor Receptor 1 (VEGFR1) Recombinant, Porcine
157315-02 50 µg

Vascular Endothelial Growth Factor Receptor 1 (VEGFR1) Recombinant, Porcine

Sign In for Pricing
View Details
Vascular Endothelial Growth Factor Receptor 1 (VEGFR1) Recombinant, Porcine
157315-03 200 µg

Vascular Endothelial Growth Factor Receptor 1 (VEGFR1) Recombinant, Porcine

Sign In for Pricing
View Details
POU2AF1 Antibody
orb607639-01 20 µg

POU2AF1 Antibody

Sign In for Pricing
View Details
POU2AF1 Antibody
orb607639-02 100 µg

POU2AF1 Antibody

Sign In for Pricing
View Details
POU2AF1 Antibody
orb607639-03 100 ug (without BSA and Azide)

POU2AF1 Antibody

Sign In for Pricing
View Details