Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Thermoplasma acidophilum Cobalamin synthase (cobS)

This Recombinant Thermoplasma acidophilum Cobalamin synthase (cobS) spans the amino acid sequence from region 1-255.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q9HJ91

Expression Region

1-255

Origin

Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKGLRSAFSFFTIIPIKSELDEHLIAYVPLVALFDAALAASLYVAIYGISKLLASFISVS AIYIVNGLNHVDAVADAGDAMMIRNRSRIREVFEDHDVGAGGVFTLIFVYLLALISLSSM DLYIGIFSIILAEFLSKSMMMITLHRSRPLFQGIGSLFIDLYRKHDSLYTVEFVVIPIVL ALLSRASIMISVALAFLIFIIVKMAVIRRFGGINGDLAGFIGELGRSIFLMISLIMAQSS VLSTYDILSKIMSSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD43 (84-3C1), CF647 conjugate, 0.1mg/mL
BNC470342-500 1x 500 µL

CD43 (84-3C1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF647 conjugate, 0.1mg/mL
BNC470333-100 1x 100 µL

CD8 (RIV11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF640R conjugate, 0.1mg/mL
BNC400032-500 1x 500 µL

MUC2 (CCP58), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF740 conjugate, 0.1mg/mL
BNC740345-500 1x 500 µL

CD4 (EDU-2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF488A conjugate, 0.1mg/mL
BNC881081-100 1x 100 µL

CD45RO (190-2F2.5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF640R conjugate, 0.1mg/mL
BNC400050-500 1x 500 µL

IgA Secretory Component (SC05), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details