Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sorangium cellulosum ATP synthase subunit a (atpB)

This Recombinant Sorangium cellulosum ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-255.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A9FGS5

Expression Region

1-255

Origin

Sorangium cellulosum (strain So ce56) (Polyangium cellulosum (strain So ce56) )

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPEHTGFLTYLLAQLPGLRENARNIGKTFIGHHTVDYRGTEPIFMSLLIMVLFVLLASEV RGQYRRLNESVIPEDKLTLRTFFEAFFGYFYGMARDVMGPANAKRYFPLIGGSAAFIFFS NASALIPGVNPPTSNLNITIGCAVVVFVLFNYYGLKENGWSYVAHLAGPKWYLAPLIFPI EVISTCVRPVTLSIRLMLNIGVDHLVASIFLGLVALFVPVPLMFLAIIVIVVQTLVFCLL SCIYIGLATEKADHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD53 (161-2), CF568 conjugate, 0.1mg/mL
BNC680324-500 1x 500 µL

CD53 (161-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF488A conjugate, 0.1mg/mL
BNC880193-100 1x 100 µL

CD86 (BU63), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF647 conjugate, 0.1mg/mL
BNC470181-100 1x 100 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C-Myc (9E10.3), CF770 conjugate, 0.1mg/mL
BNC700596-500 1x 500 µL

C-Myc (9E10.3), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRAcP (Tartrate-Resistant Acid Phosphatase) (Hairy Cell Leukemia Marker) (rACP5/1070), CF640R conjugate, 0.1mg/mL
BNC402337-100 1x 100 µL

TRAcP (Tartrate-Resistant Acid Phosphatase) (Hairy Cell Leukemia Marker) (rACP5/1070), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/1986), CF568 conjugate, 0.1mg/mL
BNC681986-500 1x 500 µL

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/1986), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details