Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Uncharacterized membrane protein BU139 (BU139)

This Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Uncharacterized membrane protein BU139 (BU139) spans the amino acid sequence from region 1-256.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein BU139

UniProt

P57239

Expression Region

1-256

Origin

Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) (Acyrthosiphon pisum symbiotic bacterium)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESWLTSFITQSLVYSLLVVGIVSFLESLALVGLLLPGIILMTTLGTFIGDGKLSFYPAW ISGTTGCLLGDWISYYIGLYFKNWLYNFNFLKKNQKLLDKTKSFLDKHSMLTIILGRFIG PTRPLIPMVSGMLKLPLKKFVFPSIIGCILWPPVYFFPGIVTGIAIKIPESSQSYYFKWL LLLISILIWLGIWLISKWWKMRKNHIDNRTSFFTKKKIGWLAILTMSSGILSLIAIQFHP TMLIFREIFSTILLGT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Inositol Polyphosphate-4-Phosphatase Type I 107kDa ELISA Kit
OM621860 96 Strip Well

Bovine Inositol Polyphosphate-4-Phosphatase Type I 107kDa ELISA Kit

Sign In for Pricing
View Details
Anti-ZYX antibody
STJ72081 100 µg

Anti-ZYX antibody

Sign In for Pricing
View Details
RPS17P1 3'UTR GFP Stable Cell Line
TU072040 1.0 mL

RPS17P1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Beclin 1 Rabbit Monoclonal Antibody
E28G1028 100 µL

Beclin 1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Rat Insulin-Like Growth Factor-Binding Protein 1 (IGFBP1) Protein
abx656060-01 50 µg

Rat Insulin-Like Growth Factor-Binding Protein 1 (IGFBP1) Protein

Sign In for Pricing
View Details
Rat Insulin-Like Growth Factor-Binding Protein 1 (IGFBP1) Protein
abx656060-02 100 µg

Rat Insulin-Like Growth Factor-Binding Protein 1 (IGFBP1) Protein

Sign In for Pricing
View Details