Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Surface presentation of antigens protein spaR (spaR)

This Recombinant Surface presentation of antigens protein spaR (spaR) spans the amino acid sequence from region 1-256.

Product Specifications

Product Name Alternative

Surface presentation of antigens protein spaR, Spa29 protein

UniProt

P0A1M7

Expression Region

1-256

Origin

Shigella sonnei

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDISSWFESIHVFLILLNGVFFRLAPLFFFLPFLNNGIISPSIRIPVIFLVASGLITSGK VDIGSSVFEHVYFLMFKEIIVGLLLSFCLSLPFWIFHAVGSIIDNQRGATLSSSIDPANG VDTSELAKFFNLFSAVVFLYSGGMVFILESIQLSYNICPLFSQCSFRVSNILTFLTLLAS QAVILASPVMIVLLLSEVLLGVLSRFAPQMNAFSVSLTIKSLLAIFIIFICSSTIYFSKV QFFLGEHKFFTNLFVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (HFN7.1), CF594 conjugate, 0.1mg/mL
BNC940270-100 1x 100 µL

Fibronectin (HFN7.1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF740 conjugate, 0.1mg/mL
BNC740391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF647 conjugate, 0.1mg/mL
BNC470978-100 1x 100 µL

CD7 (T3-3A1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF640R conjugate, 0.1mg/mL
BNC400333-500 1x 500 µL

CD8 (RIV11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD1a / HTA1 (Mature Langerhans Cells Marker) (rC1A/711), CF488A conjugate, 0.1mg/mL
BNC881888-500 1x 500 µL

CD1a / HTA1 (Mature Langerhans Cells Marker) (rC1A/711), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AMACR / p504S (Prostate Cancer Marker) (AMACR/1864), CF405S conjugate, 0.1mg/mL
BNC041864-100 1x 100 µL

AMACR / p504S (Prostate Cancer Marker) (AMACR/1864), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details