Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ralstonia pickettii Cobalamin synthase (cobS)

This Recombinant Ralstonia pickettii Cobalamin synthase (cobS) spans the amino acid sequence from region 1-256.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

B2UAJ1

Expression Region

1-256

Origin

Ralstonia pickettii (strain 12J)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNALREHWQALWTAVGYFTRIPVPASVGFSQAGLNRAARYFPLIGWLVGAVAAAVYWLVL RTVPAQGVAVAVSMGATLLLTGAFHEDGLADCADGFGGGYTPEDRLRIMHDSRIGAFGAI AVCMALLLKWQLLSAMAPHSIGILVAMVAAHAASRAAAVSHLLTHDYVRAEGKAKPVAQR MRWSDALWAGVFGVVPLLWFGPMCAALIVVGLILARWLLGRYFVRRIGGITGDCLGMAQQ IFELLILWGLLAWMSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aquaporin 5 (AQP5) (C-term) Rabbit Polyclonal Antibody
AP50221PU-N 400 µL

Aquaporin 5 (AQP5) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IGFBP5 (NM_000599) Human Over-expression Lysate
LY424616 100 µg

IGFBP5 (NM_000599) Human Over-expression Lysate

Sign In for Pricing
View Details
MGMT Human Gene Knockout Kit (CRISPR)
KN201612LP 1 Kit

MGMT Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Goat IgG (Fcγ Fragment specific), AlpSdAbs® VHH (Biotin)
HA710178 100 µg

Goat IgG (Fcγ Fragment specific), AlpSdAbs® VHH (Biotin)

Sign In for Pricing
View Details
RealStar®Dengue RT-PCR Kit 3.0 RUO
283003 96 Tests

RealStar®Dengue RT-PCR Kit 3.0 RUO

Sign In for Pricing
View Details
Cytokeratin 20 Rabbit Polyclonal Antibody
ER1901-76 100 µL

Cytokeratin 20 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details