Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ralstonia pickettii Cobalamin synthase (cobS)

This Recombinant Ralstonia pickettii Cobalamin synthase (cobS) spans the amino acid sequence from region 1-256.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

B2UAJ1

Expression Region

1-256

Origin

Ralstonia pickettii (strain 12J)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNALREHWQALWTAVGYFTRIPVPASVGFSQAGLNRAARYFPLIGWLVGAVAAAVYWLVL RTVPAQGVAVAVSMGATLLLTGAFHEDGLADCADGFGGGYTPEDRLRIMHDSRIGAFGAI AVCMALLLKWQLLSAMAPHSIGILVAMVAAHAASRAAAVSHLLTHDYVRAEGKAKPVAQR MRWSDALWAGVFGVVPLLWFGPMCAALIVVGLILARWLLGRYFVRRIGGITGDCLGMAQQ IFELLILWGLLAWMSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsp60 (HSPD1) Human Gene Knockout Kit (CRISPR)
KN401281 1 Kit

Hsp60 (HSPD1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human Kappa Light Chain (B-Cell Marker) (rKLC264), CF594 conjugate, 0.1mg/mL
BNC942171-100 1x 100 µL

Human Kappa Light Chain (B-Cell Marker) (rKLC264), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E2F4/E2F5 Rabbit Polyclonal Antibody
AP06091PU-N 100 µg

E2F4/E2F5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Trichostatin A
A009-10MG 10 mg

Trichostatin A

Sign In for Pricing
View Details
RBMY1D Rabbit Polyclonal Antibody
TA368734 100 µL

RBMY1D Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD163 (Monocyte & Macrophage Marker) (M130/2164), CF405S conjugate, 0.1mg/mL
BNC042164-500 1x 500 µL

CD163 (Monocyte & Macrophage Marker) (M130/2164), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details