Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ralstonia pickettii Cobalamin synthase (cobS)

This Recombinant Ralstonia pickettii Cobalamin synthase (cobS) spans the amino acid sequence from region 1-256.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

B2UAJ1

Expression Region

1-256

Origin

Ralstonia pickettii (strain 12J)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNALREHWQALWTAVGYFTRIPVPASVGFSQAGLNRAARYFPLIGWLVGAVAAAVYWLVL RTVPAQGVAVAVSMGATLLLTGAFHEDGLADCADGFGGGYTPEDRLRIMHDSRIGAFGAI AVCMALLLKWQLLSAMAPHSIGILVAMVAAHAASRAAAVSHLLTHDYVRAEGKAKPVAQR MRWSDALWAGVFGVVPLLWFGPMCAALIVVGLILARWLLGRYFVRRIGGITGDCLGMAQQ IFELLILWGLLAWMSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARL6IP4 (NM_001278380) Human Tagged ORF Clone
RG236719 10 µg

ARL6IP4 (NM_001278380) Human Tagged ORF Clone

Sign In for Pricing
View Details
Tissue FFPE Sections, Thyroid gland
CS806457 5x 5 µm

Tissue FFPE Sections, Thyroid gland

Sign In for Pricing
View Details
NR2F6 (N-term) Rabbit Polyclonal Antibody
AP52933PU-N 400 µL

NR2F6 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MIR4743 Human qPCR Primer Pair (MI0017381)
HP301129 200 Reactions

MIR4743 Human qPCR Primer Pair (MI0017381)

Sign In for Pricing
View Details
MDP1 (NM_138476) Human Over-expression Lysate
LC403357 20 µg

MDP1 (NM_138476) Human Over-expression Lysate

Sign In for Pricing
View Details
Apolipoprotein L 1 (APOL1) Rabbit Polyclonal Antibody
TA383740 100 µL

Apolipoprotein L 1 (APOL1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details