Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Cytochrome b ascorbate-dependent protein 3 (Cybasc3)

This Recombinant Rat Cytochrome b ascorbate-dependent protein 3 (Cybasc3) spans the amino acid sequence from region 1-256.

Product Specifications

Product Name Alternative

Cytochrome b ascorbate-dependent protein 3, EC= 1.-.-.-

UniProt

Q5U2W7

Expression Region

1-256

Origin

Rattus norvegicus (Rat)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASGWFYMSCMVLGSLGSMCILFTTYWMQYWRGGFAWDGTVLMFNWHPVLMVSGMVVLYG AASLVYRLPASWVGPKLPWKVLHAALHLLAFTVTVVGLTAVFGFHNHSKITHLYSLHSWL GITTVALFACQWFLGFAVFLLPWASQWLRSLLKPVHVFFGACILSLSIASVISGINEKLF FVLKNATRPYSSLPGEAVFANSTGILVVSFGLLVLYILLASSWRRPDPGALTDRQVWLLV SHYRWDKAKKACFAPC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Kidney
CS800428 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
Purified Anti-Human CD235 Antibody[HIR2]
E-AB-F1080A-01 25 µg

Purified Anti-Human CD235 Antibody[HIR2]

Sign In for Pricing
View Details
Purified Anti-Human CD235 Antibody[HIR2]
E-AB-F1080A-02 100 µg

Purified Anti-Human CD235 Antibody[HIR2]

Sign In for Pricing
View Details
GJB3 (NM_001005752) Human Over-expression Lysate
LY423651 100 µg

GJB3 (NM_001005752) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Thyroid gland
CS802794 5x 5 µm

Tissue FFPE Sections, Thyroid gland

Sign In for Pricing
View Details
Carcinoembryonic Antigen (CEA) / CD66 (rC66/1009), Biotin conjugate, 0.1mg/mL
BNCB2054-100 1x 100 µL

Carcinoembryonic Antigen (CEA) / CD66 (rC66/1009), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details