Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Cytochrome b ascorbate-dependent protein 3 (Cybasc3)

This Recombinant Rat Cytochrome b ascorbate-dependent protein 3 (Cybasc3) spans the amino acid sequence from region 1-256.

Product Specifications

Product Name Alternative

Cytochrome b ascorbate-dependent protein 3, EC= 1.-.-.-

UniProt

Q5U2W7

Expression Region

1-256

Origin

Rattus norvegicus (Rat)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASGWFYMSCMVLGSLGSMCILFTTYWMQYWRGGFAWDGTVLMFNWHPVLMVSGMVVLYG AASLVYRLPASWVGPKLPWKVLHAALHLLAFTVTVVGLTAVFGFHNHSKITHLYSLHSWL GITTVALFACQWFLGFAVFLLPWASQWLRSLLKPVHVFFGACILSLSIASVISGINEKLF FVLKNATRPYSSLPGEAVFANSTGILVVSFGLLVLYILLASSWRRPDPGALTDRQVWLLV SHYRWDKAKKACFAPC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Aminobenzylcyanide, Hydrochloride
TRC-A596925-500MG 500 mg

2-Aminobenzylcyanide, Hydrochloride

Sign In for Pricing
View Details
ITPRIP (NM_033397) Human Over-expression Lysate
LY403247 100 µg

ITPRIP (NM_033397) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Cofilin 1, Non Muscle (CFL1) ELISA Kit
RDR-CFL1-Hu-01 96 Tests

Human Cofilin 1, Non Muscle (CFL1) ELISA Kit

Sign In for Pricing
View Details
Human Cofilin 1, Non Muscle (CFL1) ELISA Kit
RDR-CFL1-Hu-02 48 Tests

Human Cofilin 1, Non Muscle (CFL1) ELISA Kit

Sign In for Pricing
View Details
Rat ALB (Albumin) ELISA Kit
E-EL-R3071-01 24 Tests

Rat ALB (Albumin) ELISA Kit

Sign In for Pricing
View Details
Rat ALB (Albumin) ELISA Kit
E-EL-R3071-02 48 Tests

Rat ALB (Albumin) ELISA Kit

Sign In for Pricing
View Details