Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pichia canadensis ATP synthase subunit a (ATP6)

This Recombinant Pichia canadensis ATP synthase subunit a (ATP6) spans the amino acid sequence from region 1-256.

Product Specifications

Product Name Alternative

ATP synthase subunit a, F-ATPase protein 6

UniProt

P48879

Expression Region

1-256

Origin

Pichia canadensis (Yeast) (Hansenula wingei)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTNIIVNSPLDQFDIKVFIGFVSPFIDLTNINITTFTVYSVFILIVILGLTLLTDNNGRI IGNRWYVSQEAMYDTINNMVSGQIGGKLGGYYFPLIYTFFIFIFTANLIGMIPYSFAITS HMVFIISLSVVIWLGVTIIGLYTHGLTFFALFVPAGCPLALAPLLVLIELLSYSARAISL GLRLSANTLSGHLLMVILGGLVFNLMSVSIVTFVLGFIPLAGILAIVALEFAIAMIQSYV FAILASGYIKDGLYLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD47 (B6H12.2), CF740 conjugate, 0.1mg/mL
BNC740437-500 1x 500 µL

CD47 (B6H12.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF568 conjugate, 0.1mg/mL
BNC682216-100 1x 100 µL

CD50 / ICAM3 (CG106), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF740 conjugate, 0.1mg/mL
BNC740266-100 1x 100 µL

Human IgG Immunoglobulin (IG266), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF568 conjugate, 0.1mg/mL
BNC680034-500 1x 500 µL

Cytokeratin 8/18 (C-51), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF647 conjugate, 0.1mg/mL
BNC470437-500 1x 500 µL

CD47 (B6H12.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SUMO-2 (SUMO2/1199), CF594 conjugate, 0.1mg/mL
BNC941199-100 1x 100 µL

SUMO-2 (SUMO2/1199), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details