Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein yceF (yceF)

This Recombinant Bacillus subtilis Uncharacterized membrane protein yceF (yceF) spans the amino acid sequence from region 1-257.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yceF

UniProt

O34447

Expression Region

1-257

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDFLHHILSTYASFFDWKMWGEVLTDPVSWGLIGSLVVLEGLLSADNALVLAVMVKHLPE KQRKKALTYGLFGAYIFRFIFIGLGMLLIKFWWIKVLGALYLAWLVIKHFWIGEKEEEAD GMKKNSWMVRTFGIFWATVISVELMDLAFSVDSILAAFAVSEKVWVLLIGGMLGILMMRT VAKVFLVLIDKIPELENTAFVLIGIIALKMAGSAFHYEMPHSVFFIIIIAAFAVTLIIHY INKQKQVREQTAASKEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TLR1 rabbit polyclonal antibody
TA321566 100 µL

Anti-TLR1 rabbit polyclonal antibody

Sign In for Pricing
View Details
DPP4/CD26 Antibody
orb1534524 50 µg

DPP4/CD26 Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Complement Factor H Antibody (OTI5H5) [DyLight 650]
NBP2-70883C 0.1 mL

Mouse Monoclonal Complement Factor H Antibody (OTI5H5) [DyLight 650]

Sign In for Pricing
View Details
Ppid ORF Vector (Mouse) (pORF)
37358014 1.0 µg DNA

Ppid ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
RAC2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV635763 1.0 µg DNA

RAC2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Hyperwightin D
T125247-01 1 mg

Hyperwightin D

Sign In for Pricing
View Details