Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein yceF (yceF)

This Recombinant Bacillus subtilis Uncharacterized membrane protein yceF (yceF) spans the amino acid sequence from region 1-257.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yceF

UniProt

O34447

Expression Region

1-257

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDFLHHILSTYASFFDWKMWGEVLTDPVSWGLIGSLVVLEGLLSADNALVLAVMVKHLPE KQRKKALTYGLFGAYIFRFIFIGLGMLLIKFWWIKVLGALYLAWLVIKHFWIGEKEEEAD GMKKNSWMVRTFGIFWATVISVELMDLAFSVDSILAAFAVSEKVWVLLIGGMLGILMMRT VAKVFLVLIDKIPELENTAFVLIGIIALKMAGSAFHYEMPHSVFFIIIIAAFAVTLIIHY INKQKQVREQTAASKEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPM1D Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-22939R-APC-Cy5.5 100 µL

PPM1D Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
Recombinant Human PNOC Protein, N-His
bs-101939P-01 20 µg

Recombinant Human PNOC Protein, N-His

Sign In for Pricing
View Details
Recombinant Human PNOC Protein, N-His
bs-101939P-02 50 µg

Recombinant Human PNOC Protein, N-His

Sign In for Pricing
View Details
JZP-430
BA7955-25 25 mg

JZP-430

Sign In for Pricing
View Details
Cyclin D1 antibody
70R-30875 0.1 mg

Cyclin D1 antibody

Sign In for Pricing
View Details
Mouse GC (Glucagon) ELISA Kit
EK242290 96 Well

Mouse GC (Glucagon) ELISA Kit

Sign In for Pricing
View Details