Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella woodyi Cobalamin synthase (cobS)

This Recombinant Shewanella woodyi Cobalamin synthase (cobS) spans the amino acid sequence from region 1-257.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

B1KH27

Expression Region

1-257

Origin

Shewanella woodyi (strain ATCC 51908 / MS32)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHVLRQQLTLFFIAMGFFTRIPMPTWVKVDGESLNKANRYFGLIGLLVGGICALVYEITR GFLPVSVSIIFAMIAGLVVTGGFHEDGLADTADGLGGGWSVADKLKIMKDSRIGTYGALA LVMGLMLKFILLSELALYNPDLVVTALIVGHTLSRVMAASLIFSQSYVRDDDSSKSKPLA QNQTVNELLILLATAVLVLWCSGLSGGLYIAIGLVLLRWGLIYLFHRQIGGYTGDTLGAT QQLAELACYLMLLGFSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,4-Dinitrobenzyl Bromide
TRC-D680470-100MG 100 mg

2,4-Dinitrobenzyl Bromide

Sign In for Pricing
View Details
Glycidamide
TRC-G615250-500MG 500 mg

Glycidamide

Sign In for Pricing
View Details
Stx5a Mouse Gene Knockout Kit (CRISPR)
KN516932 1 Kit

Stx5a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF640R conjugate, 0.1mg/mL
BNC400266-100 1x 100 µL

Human IgG Immunoglobulin (IG266), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IL-25 Recombinant Rabbit monoclonal Antibody
HA725018B 100 µL

Human IL-25 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1388), Biotin conjugate, 0.1mg/mL
BNCB1388-100 1x 100 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1388), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details