Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella woodyi Cobalamin synthase (cobS)

This Recombinant Shewanella woodyi Cobalamin synthase (cobS) spans the amino acid sequence from region 1-257.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

B1KH27

Expression Region

1-257

Origin

Shewanella woodyi (strain ATCC 51908 / MS32)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHVLRQQLTLFFIAMGFFTRIPMPTWVKVDGESLNKANRYFGLIGLLVGGICALVYEITR GFLPVSVSIIFAMIAGLVVTGGFHEDGLADTADGLGGGWSVADKLKIMKDSRIGTYGALA LVMGLMLKFILLSELALYNPDLVVTALIVGHTLSRVMAASLIFSQSYVRDDDSSKSKPLA QNQTVNELLILLATAVLVLWCSGLSGGLYIAIGLVLLRWGLIYLFHRQIGGYTGDTLGAT QQLAELACYLMLLGFSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PBR (1D4) Monoclonal Antibody
bsm-52249R 100 µL

PBR (1D4) Monoclonal Antibody

Sign In for Pricing
View Details
GTSE1 Peptide - N-terminal region
MBS3231361-01 0.1 mg

GTSE1 Peptide - N-terminal region

Sign In for Pricing
View Details
GTSE1 Peptide - N-terminal region
MBS3231361-02 5x 0.1 mg

GTSE1 Peptide - N-terminal region

Sign In for Pricing
View Details
Slc25a11 sgRNA CRISPR Lentivector set (Rat)
K7043401 3x 1.0 µg

Slc25a11 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Recombinant Human Roundabout homolog 3 (ROBO3), partial
CSB-EP846671HUb1-01 20 µg

Recombinant Human Roundabout homolog 3 (ROBO3), partial

Sign In for Pricing
View Details
Recombinant Human Roundabout homolog 3 (ROBO3), partial
CSB-EP846671HUb1-02 100 µg

Recombinant Human Roundabout homolog 3 (ROBO3), partial

Sign In for Pricing
View Details