Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Alkalilimnicola ehrlichei Cobalamin synthase (cobS)

This Recombinant Alkalilimnicola ehrlichei Cobalamin synthase (cobS) spans the amino acid sequence from region 1-257.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q0A4T1

Expression Region

1-257

Origin

Alkalilimnicola ehrlichei (strain MLHE-1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTAVRGLLLALAFLTRLPVWWLGPPRREDHAASLPAYPVVGLILGILLLALYALLQWFF PDQFVVQAALLVAAWALVTGLLHLDGLGDSADAWLGGHGDRLRSLEIMKDPRSGPAAVAV ITLALVVKVAALAALLRLDAALAALLIAPVLGRAAAALLIAGTPYARKQGLAGPLAEAPA TRWIGLTALGALLFVTALAGWAGLAAVLGVVAVGVWAQHLMMRRLDGFTGDTAGALVEVA ELAALLGLLAVLANSAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat α-Gal ELISA Kit
EGTAF0013 96 Tests

Goat α-Gal ELISA Kit

Sign In for Pricing
View Details
Chicken Epoxide hydrolase 2 (EPHX2) ELISA kit
GTR10443670 96 Well

Chicken Epoxide hydrolase 2 (EPHX2) ELISA kit

Sign In for Pricing
View Details
Canine Immunoglobulin E ELISA Kit
MBS766036-01 48 Well

Canine Immunoglobulin E ELISA Kit

Sign In for Pricing
View Details
Canine Immunoglobulin E ELISA Kit
MBS766036-02 96 Well

Canine Immunoglobulin E ELISA Kit

Sign In for Pricing
View Details
Canine Immunoglobulin E ELISA Kit
MBS766036-03 5x 96 Well

Canine Immunoglobulin E ELISA Kit

Sign In for Pricing
View Details
Canine Immunoglobulin E ELISA Kit
MBS766036-04 10x 96 Well

Canine Immunoglobulin E ELISA Kit

Sign In for Pricing
View Details