Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Uncharacterized membrane protein bbp_130 (bbp_130)

This Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Uncharacterized membrane protein bbp_130 (bbp_130) spans the amino acid sequence from region 1-257.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein bbp_130

UniProt

Q89AV4

Expression Region

1-257

Origin

Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METWFLYFITKSISYALFMVLIVTFLESLALVGLFLPGIVLMSILGTLIGNGTLSFYPAW IVGIIGCMCGDWISYYCGFKFKKCITNLHLLKNNNVVLDKITNTLTNYPITTILLGRFIG PTRPLVPMVCGMLNISLKTFIIPNILGCILWPPIYFLPGIFTGIAISNTTNYSENTYFKI QFLAAILLIWLGIFLLWKLWKRYTDTGKKKIYISNVNLCLLLTISLSAGITIMIYIQSNS TLIFFRKILWKILISSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD47 (B6H12.2), CF568 conjugate, 0.1mg/mL
BNC680437-100 1x 100 µL

CD47 (B6H12.2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF740 conjugate, 0.1mg/mL
BNC740176-500 1x 500 µL

CD5 (Cris-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF405S conjugate, 0.1mg/mL
BNC040851-100 1x 100 µL

HSP60 (LK1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF488A conjugate, 0.1mg/mL
BNC880177-500 1x 500 µL

CD50 (ICAM-3) (101-1D2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF640R conjugate, 0.1mg/mL
BNC401050-100 1x 100 µL

CD3e (CRIS-7), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD56 / NCAM (123C3.D5 + 123A8), CF405S conjugate, 0.1mg/mL
BNC040693-500 1x 500 µL

CD56 / NCAM (123C3.D5 + 123A8), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details