Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Uncharacterized membrane protein bbp_130 (bbp_130)

This Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Uncharacterized membrane protein bbp_130 (bbp_130) spans the amino acid sequence from region 1-257.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein bbp_130

UniProt

Q89AV4

Expression Region

1-257

Origin

Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METWFLYFITKSISYALFMVLIVTFLESLALVGLFLPGIVLMSILGTLIGNGTLSFYPAW IVGIIGCMCGDWISYYCGFKFKKCITNLHLLKNNNVVLDKITNTLTNYPITTILLGRFIG PTRPLVPMVCGMLNISLKTFIIPNILGCILWPPIYFLPGIFTGIAISNTTNYSENTYFKI QFLAAILLIWLGIFLLWKLWKRYTDTGKKKIYISNVNLCLLLTISLSAGITIMIYIQSNS TLIFFRKILWKILISSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

THAP1 AAV Vector (Human) (CMV)
46627101 1 µg

THAP1 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
CD98 Rabbit mAb
E2R383101 100 µL

CD98 Rabbit mAb

Sign In for Pricing
View Details
MASTL Antibody
A15611-100UG 100 µg

MASTL Antibody

Sign In for Pricing
View Details
Med8 Mouse siRNA Oligo Duplex (Locus ID 80509)
SR407667 1 Kit

Med8 Mouse siRNA Oligo Duplex (Locus ID 80509)

Sign In for Pricing
View Details
ARL6 Antibody
A60342-50UL 50 μL

ARL6 Antibody

Sign In for Pricing
View Details
Anti-IKBL1 antibody
STJ190419 200 µl

Anti-IKBL1 antibody

Sign In for Pricing
View Details