Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nodulation protein J (nodJ)

This Recombinant Nodulation protein J (nodJ) spans the amino acid sequence from region 1-259.

Product Specifications

Product Name Alternative

Nodulation protein J

UniProt

P06755

Expression Region

1-259

Origin

Rhizobium leguminosarum bv. viciae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGVATLPAGGLNWLAVWRRNYLAWKKAALASILGNLADPVIYLFGLGAGLGVMVGRVDGV SYTAFLAAGMIATSAMTAATFETIYAAFGRMQGQRTWEAMLYTQLTQGDIVVGEMAWAAT KASLAGTGIGIVAAMLGYTHWLALLYALPVIAITGLAFASLGMVVTALAPSYDYFIFYQT LVITPMLFLSGAVFPVDQLPVAFQQIAAFLPLAHSIDLIRPTMLGQPIANVCLHIGVLCI YIVVPFLVSTALLRRRLMR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BHI & 10% Glycerol
MED1138 50 / PCK

BHI & 10% Glycerol

Sign In for Pricing
View Details
Recombinant Thiomicrospira crunogena Prolipoprotein diacylglyceryl transferase (lgt)
orb2907803-01 20 µg

Recombinant Thiomicrospira crunogena Prolipoprotein diacylglyceryl transferase (lgt)

Sign In for Pricing
View Details
Recombinant Thiomicrospira crunogena Prolipoprotein diacylglyceryl transferase (lgt)
orb2907803-02 100 µg

Recombinant Thiomicrospira crunogena Prolipoprotein diacylglyceryl transferase (lgt)

Sign In for Pricing
View Details
Rabbit Polyclonal CUEDC2 Antibody
NBP2-24639 0.1 mg

Rabbit Polyclonal CUEDC2 Antibody

Sign In for Pricing
View Details
Map3k2 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4705502 1.0 µg DNA

Map3k2 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
WM-101-PK AB Labels
010101 Pack of 625 Label(s)

WM-101-PK AB Labels

Sign In for Pricing
View Details