Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nodulation protein J (nodJ)

This Recombinant Nodulation protein J (nodJ) spans the amino acid sequence from region 1-259.

Product Specifications

Product Name Alternative

Nodulation protein J

UniProt

P06755

Expression Region

1-259

Origin

Rhizobium leguminosarum bv. viciae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGVATLPAGGLNWLAVWRRNYLAWKKAALASILGNLADPVIYLFGLGAGLGVMVGRVDGV SYTAFLAAGMIATSAMTAATFETIYAAFGRMQGQRTWEAMLYTQLTQGDIVVGEMAWAAT KASLAGTGIGIVAAMLGYTHWLALLYALPVIAITGLAFASLGMVVTALAPSYDYFIFYQT LVITPMLFLSGAVFPVDQLPVAFQQIAAFLPLAHSIDLIRPTMLGQPIANVCLHIGVLCI YIVVPFLVSTALLRRRLMR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIRPα/SHPS1 (D6I3M) Rabbit Monoclonal Antibody
CST 13379S 100 µL

SIRPα/SHPS1 (D6I3M) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Lenses, Meniscus +8D
1110082 1 Each

Lenses, Meniscus +8D

Sign In for Pricing
View Details
SENP6, CT (Sentrin-specific protease 6, Sentrin/SUMO-specific protease SENP6, SUMO-1-specific protease 1, SENP6, KIAA0797, SSP1, SUSP1)
MBS645620-01 0.2 mL

SENP6, CT (Sentrin-specific protease 6, Sentrin/SUMO-specific protease SENP6, SUMO-1-specific protease 1, SENP6, KIAA0797, SSP1, SUSP1)

Sign In for Pricing
View Details
SENP6, CT (Sentrin-specific protease 6, Sentrin/SUMO-specific protease SENP6, SUMO-1-specific protease 1, SENP6, KIAA0797, SSP1, SUSP1)
MBS645620-02 5x 0.2 mL

SENP6, CT (Sentrin-specific protease 6, Sentrin/SUMO-specific protease SENP6, SUMO-1-specific protease 1, SENP6, KIAA0797, SSP1, SUSP1)

Sign In for Pricing
View Details
1- (2-Fluorophenyl) -4-hydroxy-1H-pyrazole-3-carboxylic acid
CWB60204-01 250 mg

1- (2-Fluorophenyl) -4-hydroxy-1H-pyrazole-3-carboxylic acid

Sign In for Pricing
View Details
1- (2-Fluorophenyl) -4-hydroxy-1H-pyrazole-3-carboxylic acid
CWB60204-02 2.5 g

1- (2-Fluorophenyl) -4-hydroxy-1H-pyrazole-3-carboxylic acid

Sign In for Pricing
View Details