Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella pealeana Cobalamin synthase (cobS)

This Recombinant Shewanella pealeana Cobalamin synthase (cobS) spans the amino acid sequence from region 1-259.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A8H806

Expression Region

1-259

Origin

Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQAWQQQLNLFFIAMGFFTRIPMPKWIEVDADKLNKASRYFGLVGLLVGAISALVYTLML YWVSPSIAIVLAMITSVLVTGGFHEDGLADTADGLGGGWTVEAKLNIMKDSRLGSYGALA LVLALLLKWQLLTELALFDPSSVSLALIVGHCLSRVVAASFIFSEPYVSDSDTSKSKPLA QEQGINELSILLATGILALLLVGVMQALVLTLALTIVRYGFVRLFTKQIGGYTGDTLGAA QQGSELTCYLLLLVLGVSW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thioredoxin Domain-containing Protein 4 (TXNDC4, Endoplasmic Reticulum Resident Protein 44, ER Protein 44, ERp44, KIAA0573, PDIA10, UNQ532/PRO1075) (MaxLight 750)
MBS6397708-01 0.1 mL

Thioredoxin Domain-containing Protein 4 (TXNDC4, Endoplasmic Reticulum Resident Protein 44, ER Protein 44, ERp44, KIAA0573, PDIA10, UNQ532/PRO1075) (MaxLight 750)

Sign In for Pricing
View Details
Thioredoxin Domain-containing Protein 4 (TXNDC4, Endoplasmic Reticulum Resident Protein 44, ER Protein 44, ERp44, KIAA0573, PDIA10, UNQ532/PRO1075) (MaxLight 750)
MBS6397708-02 5x 0.1 mL

Thioredoxin Domain-containing Protein 4 (TXNDC4, Endoplasmic Reticulum Resident Protein 44, ER Protein 44, ERp44, KIAA0573, PDIA10, UNQ532/PRO1075) (MaxLight 750)

Sign In for Pricing
View Details
BDP1 siRNA (Mouse)
CRN5136-01 15 nmol

BDP1 siRNA (Mouse)

Sign In for Pricing
View Details
BDP1 siRNA (Mouse)
CRN5136-02 30 nmol

BDP1 siRNA (Mouse)

Sign In for Pricing
View Details
SM-6586 5mg
A20723-5 5 mg

SM-6586 5mg

Sign In for Pricing
View Details
Hsa-miR-128-2-5p miRNA Antagomir
CIJ2565-01 10 nmol

Hsa-miR-128-2-5p miRNA Antagomir

Sign In for Pricing
View Details