Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella pealeana Cobalamin synthase (cobS)

This Recombinant Shewanella pealeana Cobalamin synthase (cobS) spans the amino acid sequence from region 1-259.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A8H806

Expression Region

1-259

Origin

Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQAWQQQLNLFFIAMGFFTRIPMPKWIEVDADKLNKASRYFGLVGLLVGAISALVYTLML YWVSPSIAIVLAMITSVLVTGGFHEDGLADTADGLGGGWTVEAKLNIMKDSRLGSYGALA LVLALLLKWQLLTELALFDPSSVSLALIVGHCLSRVVAASFIFSEPYVSDSDTSKSKPLA QEQGINELSILLATGILALLLVGVMQALVLTLALTIVRYGFVRLFTKQIGGYTGDTLGAA QQGSELTCYLLLLVLGVSW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal CALML5 Antibody [Alexa Fluor 488]
NBP2-99872AF488 0.1 mL

Rabbit Polyclonal CALML5 Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
Cleavage Stimulation Factor 2, NT (Cleavage Stimulation Factor 64kD Subunit, CSTF 64kD Subunit, CF-1 64kD Subunit, CstF-64, CSTF2) (MaxLight 490) discontinued
C7946-70C-ML490 100 µL

Cleavage Stimulation Factor 2, NT (Cleavage Stimulation Factor 64kD Subunit, CSTF 64kD Subunit, CF-1 64kD Subunit, CstF-64, CSTF2) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Zfp275 sgRNA CRISPR Lentivector set (Rat)
K6453401 3x 1.0 µg

Zfp275 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Smad1 Rabbit Polyclonal Antibody (APC)
orb2575259 100 µg

Smad1 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Human CD223/LAG3 Antibody , FITC
E55A07332 50 Tests

Human CD223/LAG3 Antibody , FITC

Sign In for Pricing
View Details
Chicken Breast Cancer Susceptibility Protein 1 (BRCA1) ELISA Kit
MBS2802388-01 48 Tests

Chicken Breast Cancer Susceptibility Protein 1 (BRCA1) ELISA Kit

Sign In for Pricing
View Details