Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella pealeana Cobalamin synthase (cobS)

This Recombinant Shewanella pealeana Cobalamin synthase (cobS) spans the amino acid sequence from region 1-259.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A8H806

Expression Region

1-259

Origin

Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQAWQQQLNLFFIAMGFFTRIPMPKWIEVDADKLNKASRYFGLVGLLVGAISALVYTLML YWVSPSIAIVLAMITSVLVTGGFHEDGLADTADGLGGGWTVEAKLNIMKDSRLGSYGALA LVLALLLKWQLLTELALFDPSSVSLALIVGHCLSRVVAASFIFSEPYVSDSDTSKSKPLA QEQGINELSILLATGILALLLVGVMQALVLTLALTIVRYGFVRLFTKQIGGYTGDTLGAA QQGSELTCYLLLLVLGVSW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dbil5 CRISPR Activation Plasmid (m)
sc-419951-ACT 20 µg

Dbil5 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Mouse Mir148a qPCR Primer Pair
QM73662S 200 Tests

Mouse Mir148a qPCR Primer Pair

Sign In for Pricing
View Details
Olr1292 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
33813116 3x 1.0 µg

Olr1292 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
FAM182A Protein Vector (Human) (pPB-C-His)
PV051905 500 ng

FAM182A Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
rno-miR-3556b miRNA Mimic
MBS8303127-01 5 nmol

rno-miR-3556b miRNA Mimic

Sign In for Pricing
View Details
rno-miR-3556b miRNA Mimic
MBS8303127-02 10 nmol

rno-miR-3556b miRNA Mimic

Sign In for Pricing
View Details