Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant O-antigen export system permease protein rfbA (rfbA)

This Recombinant O-antigen export system permease protein rfbA (rfbA) spans the amino acid sequence from region 1-259.

Product Specifications

Product Name Alternative

O-antigen export system permease protein rfbA

UniProt

Q48478

Expression Region

1-259

Origin

Klebsiella pneumoniae

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLKMKYNLGYLFDLLVVITNKDLKVRYKSSVFGYLWSIANPLLFAMIYYFIFKLVMRVQ IPNYTLFLITGLFPWQWFASSATNSLFSFIANAQIIKKTVFPRSVIPLSNVMMEGLHFLC TIPVIIAFLFVYGMRPSLSWLWGIPIIAIGQVIFTFGISIIFSTLNLFFRDLERFVSLGI MLMFYCTPILYASDMIPEKFSWIITYNPLASMILSWRELFMNGVLNYEYISILYITGFIL TIVGLAIFNKLKYRFAEIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Topoisomerase II alpha Antibody [TPM2A-2]
34-054 100 µg

Topoisomerase II alpha Antibody [TPM2A-2]

Sign In for Pricing
View Details
ACBG1 Antibody
MBS9519567-01 0.04 mL

ACBG1 Antibody

Sign In for Pricing
View Details
ACBG1 Antibody
MBS9519567-02 0.1 mL

ACBG1 Antibody

Sign In for Pricing
View Details
ACBG1 Antibody
MBS9519567-03 0.2 mL

ACBG1 Antibody

Sign In for Pricing
View Details
ACBG1 Antibody
MBS9519567-04 5x 0.2 mL

ACBG1 Antibody

Sign In for Pricing
View Details
Recombinant Plasmodium Falciparum PFE1050w Protein (aa 1-479)
VAng-Wyb6699-1mgEcoli 1 mg (E. coli)

Recombinant Plasmodium Falciparum PFE1050w Protein (aa 1-479)

Sign In for Pricing
View Details