Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant O-antigen export system permease protein rfbA (rfbA)

This Recombinant O-antigen export system permease protein rfbA (rfbA) spans the amino acid sequence from region 1-259.

Product Specifications

Product Name Alternative

O-antigen export system permease protein rfbA

UniProt

Q48475

Expression Region

1-259

Origin

Klebsiella pneumoniae

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSIKMKYNLGYLFDLLVVITNKDLKVRYKSSMLGYLWSVANPLLFAMIYYFIFKLVMRVQ IPNYTVFLITGLFPWQWFASSATNSLFSFIANAQIIKKTVFPRSVIPLSNVMMEGLHFLC TIPVIVVFLFVYGMTPSLSWVWGIPLIAIGQVIFTFGVSIIFSTLNLFFRDLERFVSLGI MLMFYCTPILYASDMIPEKFSWIITYNPLASMILSWRDLFMNGTLNYEYISILYFTGIIL TVVGLSIFNKLKYRFAEIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Muscle tissue
CS603373 5x 5 µm

Frozen Tissue Sections, Muscle tissue

Sign In for Pricing
View Details
Frizzled-5/8 Rabbit Polyclonal Antibody
ES7561-01 50 µL

Frizzled-5/8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frizzled-5/8 Rabbit Polyclonal Antibody
ES7561-02 100 µL

Frizzled-5/8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Platelet Basic Protein, NT (PBP, C-X-C Motif Chemokine 7, Leukocyte-derived Growth Factor, LDGF, Macrophage-derived Growth Factor, MDGF, CXCL7, Small-inducible Cytokine B7)
P0023-01F 200 µL

Platelet Basic Protein, NT (PBP, C-X-C Motif Chemokine 7, Leukocyte-derived Growth Factor, LDGF, Macrophage-derived Growth Factor, MDGF, CXCL7, Small-inducible Cytokine B7)

Sign In for Pricing
View Details
Human NGAL (Human Cell-Derived) Recombinant Protein C-6 His Tag 50UG
IHUNGALHCRC6HIS50UG 50 µg

Human NGAL (Human Cell-Derived) Recombinant Protein C-6 His Tag 50UG

Sign In for Pricing
View Details
FTLP5 3'UTR Luciferase Stable Cell Line
TU008354 1.0 mL

FTLP5 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details