Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Insulin-induced gene 1 protein (Insig1)

This Recombinant Mouse Insulin-induced gene 1 protein (Insig1) spans the amino acid sequence from region 1-259.

Product Specifications

Product Name Alternative

Insulin-induced gene 1 protein, INSIG-1

UniProt

Q8BGI3

Expression Region

1-259

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPRLHDHVWNYPSAGAARPYSLPRGMIAAAACPQGPGVPEPEHAPRGQRAGTTGCSARPG SWHHDLVQRSLVLFSFGVVLALVLNLLQIQRNVTLFPDEVIATIFSSAWWVPPCCGTAAA VVGLLYPCIDSHLGEPHKFKREWASVMRCIAVFVGINHASAKLDFANNVQLSLTLAALSL GLWWTFDRSRSGLGLGITIAFLATLITQFLVYNGVYQYTSPDFLYIRSWLPCIFFSGGVT VGNIGRQLAMGVPEKPHSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (VU-1D9), CF640R conjugate, 0.1mg/mL
BNC400017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF647 conjugate, 0.1mg/mL
BNC471037-500 1x 500 µL

CD44 Standard (DF1485), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF568 conjugate, 0.1mg/mL
BNC680352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF640R conjugate, 0.1mg/mL
BNC400525-500 1x 500 µL

CD63 (MX-49.129.5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF405S conjugate, 0.1mg/mL
BNC040861-500 1x 500 µL

HSP27 (G3.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thymidylate Synthase (TS106), CF640R conjugate, 0.1mg/mL
BNC400714-500 1x 500 µL

Thymidylate Synthase (TS106), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details