Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Thermoplasma volcanium Cobalamin synthase (cobS)

This Recombinant Thermoplasma volcanium Cobalamin synthase (cobS) spans the amino acid sequence from region 1-259.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q97BG1

Expression Region

1-259

Origin

Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMISGLRSSFSFFTLVPSRQKDIGNPITFLPLVVTVGALIGDSILYITWQFSHLIASFLS ISSIIIYNGLNHFDATADLGDALMVRDKSRIPEVIKDHHVGAGGIFAVIFVYGIAVLSLA RSTLYIGLVGILIGQVVSGSSMMISLIGSQPFVPGLADYFISLFRKHSVGYTIEFLAIPI IVSFIFSPLYVVIVALNLLIVQLTKTMISRRFGGINGDVIGFLGEFSRSLFIFMLIIIAH YNVASTYDIFSKMLSSFTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C9orf30 (MSANTD3) activation kit by CRISPRa
GA114098 1 Kit

Human C9orf30 (MSANTD3) activation kit by CRISPRa

Sign In for Pricing
View Details
Di-tert-Butyl Disulfide
TRC-D493745-5G 5 g

Di-tert-Butyl Disulfide

Sign In for Pricing
View Details
CD43 (DF-T1), 0.2mg/mL
BNUB0027-100 1x 100 µL

CD43 (DF-T1), 0.2mg/mL

Sign In for Pricing
View Details
PATZ1 Mouse Monoclonal Antibody [Clone ID: OTI8D6]
CF809309 100 µg

PATZ1 Mouse Monoclonal Antibody [Clone ID: OTI8D6]

Sign In for Pricing
View Details
Itopride N-Oxide
TRC-I931510-50MG 50 mg

Itopride N-Oxide

Sign In for Pricing
View Details
KIAA0284 (CEP170B) (NM_001112726) Human Over-expression Lysate
LC426376 20 µg

KIAA0284 (CEP170B) (NM_001112726) Human Over-expression Lysate

Sign In for Pricing
View Details