Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Thermoplasma volcanium Cobalamin synthase (cobS)

This Recombinant Thermoplasma volcanium Cobalamin synthase (cobS) spans the amino acid sequence from region 1-259.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q97BG1

Expression Region

1-259

Origin

Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMISGLRSSFSFFTLVPSRQKDIGNPITFLPLVVTVGALIGDSILYITWQFSHLIASFLS ISSIIIYNGLNHFDATADLGDALMVRDKSRIPEVIKDHHVGAGGIFAVIFVYGIAVLSLA RSTLYIGLVGILIGQVVSGSSMMISLIGSQPFVPGLADYFISLFRKHSVGYTIEFLAIPI IVSFIFSPLYVVIVALNLLIVQLTKTMISRRFGGINGDVIGFLGEFSRSLFIFMLIIIAH YNVASTYDIFSKMLSSFTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prohibitin (Mitochondrial Marker) (PHB/3226), Biotin conjugate, 0.1mg/mL
BNCB3226-500 1x 500 µL

Prohibitin (Mitochondrial Marker) (PHB/3226), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human DNAJC25-GNG10 activation kit by CRISPRa
GA118623 1 Kit

Human DNAJC25-GNG10 activation kit by CRISPRa

Sign In for Pricing
View Details
EEA1 (NM_003566) Human Recombinant Protein
TP315396M 100 µg

EEA1 (NM_003566) Human Recombinant Protein

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human IgM Antibody[MHM-88]
E-AB-F1172M-01 20 Tests

Elab Fluor® 647 Anti-Human IgM Antibody[MHM-88]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human IgM Antibody[MHM-88]
E-AB-F1172M-02 100 Tests

Elab Fluor® 647 Anti-Human IgM Antibody[MHM-88]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human IgM Antibody[MHM-88]
E-AB-F1172M-03 2x 100 Tests

Elab Fluor® 647 Anti-Human IgM Antibody[MHM-88]

Sign In for Pricing
View Details